accessibility menu, dialog, popup

UserName
Viewing profile as user:

Custom Enzymes and Inhibitors

A vast array of biological enzymes and inhibitors designed for use in highly specified experimental procedures.
Form 
  • (2)
  • (3)
  • (4)
  • (16)
  • (1)
  • (5)
  • (3)
  • (5)
  • (5)
  • (26)
Product Line 
  • (1)
  • (5)
Concentration 
  • (1)
  • (3)
Molecular Weight (g/mol) 
  • (1)
  • (1)
  • (1)
Percent Purity 
  • (1)
  • (1)

Filtered Search Results

Products from some of our suppliers do not display in filtered search results. Please clear all filters to see these products.

Narrow Results

Narrow Results

No results found within this category. Try removing some selected filters and try again.

category

brands

  • (2)
  • (1)
  • (7)
  • (1)
  • (1)
  • (1)
  • (26)
  • (1)
  • (4)
  • (8)
  • (3)
  • (1)
  • (1)
  • (1)
  • (5)
  • (8)
  • (1)
  • (1)
  • (1)
  • (1)
  • (3)
  • (1)
  • (1)
  • (3)
  • (20)
  • (1)
  • (2)
  • (7)
  • (1)
  • (18)
  • (38)
  • (1)
  • (11)
  • (3)
  • (40)
  • (4)
  • (1)
  • (129)
  • (8)
  • (2)
  • (184)
  • (19)
  • (2)
  • (7)
  • (4)
  • (1)
  • (7)
  • (2)
  • (120)
  • (1)
  • (1)
  • (1)
  • (1)

special interests

  • (1)
  • (6)
  • (9)
  • (1)
  • (73)

Form

  • (2)
  • (3)
  • (4)
  • (16)
  • (1)
  • (5)
  • (3)
  • (5)
  • (5)
  • (26)

Product Line

  • (1)
  • (5)

Concentration

  • (1)
  • (3)

Molecular Weight (g/mol)

  • (1)
  • (1)
  • (1)

Percent Purity

  • (1)
  • (1)

Quantity

  • (2)

Boiling Point

  • (1)

Format

  • (1)

Product Type

  • (1)

Research Category

  • (1)
16 – 30 of 518 results
16

Thermo Scientific™ EpiJET Bisulfite Conversion Kit

The EpiJET Bisulfite Conversion Kit is used for an efficient bisulfite modification of DNA for methylation analysis.

EDGE
17

Thermo Scientific™ Modification Solution I

Deanimate unmethylated cytosines and convert them to uracils. Thermo Scientific™ EpiJET™ Modification Solution I is a component of the EpiJET™ Bisulfate Conversion Kit (K1461) and may be purchased separately when additional supply is needed for more reactions. Supplied in 1.2mL aliquots.

18

MP Biomedicals™ FITC-Val-Ala-Asp(OMe)-FMK

FITC-Val-Ala-Asp(OMe)-FMK, Yellow Solid

Content And Storage Keep cool and dry
Form Solid
Product Type Proteins, Enzymes & Peptides
Molecular Weight (g/mol) 722.7
Color Yellow
Purity >95% by TLC
Concentration Peptide content: 77.6
For Use With (Application) Cell Viability Analysis
19

Novus Biologicals™ AKT1/2/3 Inhibitor Peptide Set
SDP

For use in research applications

Components Akt (Isoforms 1,2,3) Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKAVTDHPDRLWAWEKF (AKT sequence: AVTDHPDRLWAWEKF). Molecular weight: 4214. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Inhibitors AKT1/2/3
Host Species Human
Form Lyophilized
Product Type AKT1/2/3 Inhibitor Peptide Set
Molecular Weight (g/mol) 4214
For Use With (Application) Inhibition of Akt kinase activity
20

Novus Biologicals™ ERK1 Inhibitor Peptide Set
SDP

For use in research applications

Components ERK Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKGMPKKKPTPIQLN (ERK inhibitor sequence: GMPKKKPTPIQLN). Molecular weight: 3795. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Inhibitors ERK1
Host Species Human, Mouse, Rat, Hamster, Rabbit, Xenopus
Form Lyophilized
Product Type ERK1 Inhibitor Peptide Set
Molecular Weight (g/mol) 3795
For Use With (Application) Inhibition of Erk activation
21

Novus Biologicals™ Z-LE(OMe)HD(OMe)-FMK (Caspase 9 Inhibitor)
SDP

For use in research applications

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles
Inhibitors Z-LE(OMe)HD(OMe)-FMK (Caspase 9)
Form Crystalline Powder
Product Type Z-LE(OMe)HD(OMe)-FMK (Caspase 9) Inhibitor
Molecular Weight (g/mol) 690
Color Tan
For Use With (Application) In vitro assay
22

Novus Biologicals™ APE1 Redox Inhibitor
SDP

For use in research applications

23

MilliporeSigma™ Calbiochem™ STAT5 Inhibitor

Cell-permeable compound that selectively targets SH2 domain of STAT5

24

Novus Biologicals™ TIRAP (TLR2 and TLR4) Inhibitor Peptide Set
SDP

Applications: Flow Cytometry, In vitro assay

25

MP Biomedicals™ Z-Asp(OMe)-Glu(OMe)-Val-Asp(OMe)-Fluoromethylketone

Z-Asp(OMe)-Glu(OMe)-Val-Asp(OMe)-FMK is an irreversible and cell permeable inhibitor of CPP32/Apopain.

Content And Storage Store in a cool, dry place. Dessicate.
Form Solid
Product Type Z-Asp(OMe)-Glu(OMe)-Val-Asp(OMe)-Fluoromethylketone
Molecular Weight (g/mol) 668
Color White
26

8-Quinolinol, Crystal, ACS, Spectrum™ Chemical
SDP

CAS 148-24-3
Grade ACS
27

Thermo Scientific Chemicals Pimecrolimus

CAS: 137071-32-0 Molecular Formula: C43 H68 Cl N O11

CAS 137071-32-0
Molecular Formula C43 H68 Cl N O11
28

Novus Biologicals™ NFkB p50 (NLS) Inhibitor Peptide Set
SDP

Applications: Functional (Inhibition)

Components NF-kB p50 (NLS) Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKVQRKRQKLM (p50 NLS sequence: VQRKRQKLM). Molecular weight: 3529. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361
Content And Storage Aliquot and store at -20°C or -80°C. Avoid freeze-thaw cycles.
Inhibitors NFkB p105/p50
Host Species Human, Mouse, Rat, Bovine, Canine, Chicken, Xenopus
Form Lyophilized
Product Type NFkB p105/p50 Inhibitor Peptide Set
Molecular Weight (g/mol) 3529
For Use With (Application) Functional (Inhibition)
29

Novus Biologicals™ Q-VD-OPH Inhibitor Peptide
SDP

Applications: Functional, In vitro assay

Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Inhibitors Q-VD-OPH
Host Species Human
Form Semi-solid
Product Type Q-VD-OPH Inhibitor Peptide
Molecular Weight (g/mol) 513
Color Off-white
For Use With (Application) Functional, In vitro assay
30

Novus Biologicals™ TRAF-6 Inhibitor Peptide Set
SDP

Applications: In vitro assay, Block/Neutralize

Components TRAF6 Inhibitor peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKKRKIPTEDEY (TRAF6 binding sequence: RKIPTEDEY). Molecular weight: 3494. Antennapedia Control peptide: 2 x 1mg (lyophilized) DRQIKIWFQNRRMKWKK. Molecular weight: 2361.
Content And Storage Store at -20°C. Avoid freeze-thaw cycles.
Inhibitors TRAF-6
Host Species Human, Mouse, Rat
Form Lyophilized Solid
Product Type TRAF-6 Inhibitor Peptide Set
Molecular Weight (g/mol) 3494
Color White